PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00003.1.g04110.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 188aa    MW: 19212.8 Da    PI: 10.077
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00003.1.g04110.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.57.1e-393696262
                        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                  +e+ l+cprCds ntk+CyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknk+s+
  Zjn_sc00003.1.g04110.1.sm.mk 36 PEQGLRCPRCDSPNTKLCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKRSR 96
                                  67899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.9E-323894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8544094IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-264093IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MASSTAVAGG EDVVGPRAGG GNGGGGTTPQ QKPPPPEQGL RCPRCDSPNT KLCYYNNYSL  60
SQPRHFCKTC RRYWTKGGAL RNVPIGGGCR KNKRSRSSVM SASAAVAAAS SHLSLNLPMD  120
GIGVTAASAD QQVAARLGFL GVGAPVVSSP IGGTPAADYQ GAASAFGKAV HCSGYRLFTL  180
GLQCIQKL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475242e-74EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269772e-74KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982507.16e-49PREDICTED: dof zinc finger protein DOF5.7-like
SwissprotQ84TE95e-39DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLK4ABQ47e-49K4ABQ4_SETIT; Uncharacterized protein
STRINGSi036311m2e-48(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-33Dof family protein